Anti IDO1 pAb (ATL-HPA027772 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027772-25

Protein Description: indoleamine 2,3-dioxygenase 1
Gene Name: IDO1
Alternative Gene Name: IDO, INDO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031551: 62%, ENSRNOG00000031189: 66%
Entrez Gene ID: 3620
Uniprot ID: P14902
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAH
• Gene Sequence: LEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAH
• Gene ID - Mouse: ENSMUSG00000031551
• Gene ID - Rat: ENSRNOG00000031189
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IDO1 pAb (ATL-HPA027772 w/enhanced validation) – 1 Found

De Mattos-Arruda, Leticia; Sammut, Stephen-John; Ross, Edith M; Bashford-Rogers, Rachael; Greenstein, Erez; Markus, Havell; Morganella, Sandro; Teng, Yvonne; Maruvka, Yosef; Pereira, Bernard; Rueda, Oscar M; Chin, Suet-Feung; Contente-Cuomo, Tania; Mayor, Regina; Arias, Alexandra; Ali, H Raza; Cope, Wei; Tiezzi, Daniel; Dariush, Aliakbar; Dias Amarante, Tauanne; Reshef, Dan; Ciriaco, Nikaoly; Martinez-Saez, Elena; Peg, Vicente; Ramon Y Cajal, Santiago; Cortes, Javier; Vassiliou, George; Getz, Gad; Nik-Zainal, Serena; Murtaza, Muhammed; Friedman, Nir; Markowetz, Florian; Seoane, Joan; Caldas, Carlos. The Genomic and Immune Landscapes of Lethal Metastatic Breast Cancer. Cell Reports. 2019;27(9):2690-2708.e10.