Anti IDO1 pAb (ATL-HPA023149 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023149-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: IDO1
Alternative Gene Name: IDO, INDO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031551: 48%, ENSRNOG00000031189: 54%
Entrez Gene ID: 3620
Uniprot ID: P14902
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLK |
| Gene Sequence | LCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLK |
| Gene ID - Mouse | ENSMUSG00000031551 |
| Gene ID - Rat | ENSRNOG00000031189 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IDO1 pAb (ATL-HPA023149 w/enhanced validation) | |
| Datasheet | Anti IDO1 pAb (ATL-HPA023149 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IDO1 pAb (ATL-HPA023149 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti IDO1 pAb (ATL-HPA023149 w/enhanced validation) | |
| Datasheet | Anti IDO1 pAb (ATL-HPA023149 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IDO1 pAb (ATL-HPA023149 w/enhanced validation) |
| Citations for Anti IDO1 pAb (ATL-HPA023149 w/enhanced validation) – 3 Found |
| Ji, Rong; Ma, Lixiang; Chen, Xinyu; Sun, Renqiang; Zhang, Li; Saiyin, Hexige; Wei, Wenshi. Characterizing the distributions of IDO-1 expressing macrophages/microglia in human and murine brains and evaluating the immunological and physiological roles of IDO-1 in RAW264.7/BV-2 cells. Plos One. 16(11):e0258204. PubMed |
| Miao, Xiaofei; Zhang, Ye; Li, Zengyao; Huang, Longchang; Xin, Taojian; Shen, Renhui; Wang, Tong. Inhibition of indoleamine 2,3-dioxygenase 1 synergizes with oxaliplatin for efficient colorectal cancer therapy. Molecular Therapy. Methods & Clinical Development. 2021;20( 33665222):442-450. PubMed |
| Abdulla, Maysaa; Sundström, Christer; Lindskog, Cecilia; Hollander, Peter. Expression of IDO1 and PD-L2 in Patients with Benign Lymphadenopathies and Association with Autoimmune Diseases. Biomolecules. 2023;13(2) PubMed |