Anti ID2 pAb (ATL-HPA027612)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027612-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ID2
Alternative Gene Name: bHLHb26, GIG8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020644: 99%, ENSRNOG00000007237: 97%
Entrez Gene ID: 3398
Uniprot ID: Q02363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG |
| Gene Sequence | MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG |
| Gene ID - Mouse | ENSMUSG00000020644 |
| Gene ID - Rat | ENSRNOG00000007237 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ID2 pAb (ATL-HPA027612) | |
| Datasheet | Anti ID2 pAb (ATL-HPA027612) Datasheet (External Link) |
| Vendor Page | Anti ID2 pAb (ATL-HPA027612) at Atlas Antibodies |
| Documents & Links for Anti ID2 pAb (ATL-HPA027612) | |
| Datasheet | Anti ID2 pAb (ATL-HPA027612) Datasheet (External Link) |
| Vendor Page | Anti ID2 pAb (ATL-HPA027612) |
| Citations for Anti ID2 pAb (ATL-HPA027612) – 3 Found |
| Bajikar, Sameer S; Wang, Chun-Chao; Borten, Michael A; Pereira, Elizabeth J; Atkins, Kristen A; Janes, Kevin A. Tumor-Suppressor Inactivation of GDF11 Occurs by Precursor Sequestration in Triple-Negative Breast Cancer. Developmental Cell. 2017;43(4):418-435.e13. PubMed |
| Harmelink, Cristina; Peng, Yin; DeBenedittis, Paige; Chen, Hanying; Shou, Weinian; Jiao, Kai. Myocardial Mycn is essential for mouse ventricular wall morphogenesis. Developmental Biology. 2013;373(1):53-63. PubMed |
| Liu, Yuelong; Harmelink, Cristina; Peng, Yin; Chen, Yunjia; Wang, Qin; Jiao, Kai. CHD7 interacts with BMP R-SMADs to epigenetically regulate cardiogenesis in mice. Human Molecular Genetics. 2014;23(8):2145-56. PubMed |