Anti ICAM1 pAb (ATL-HPA002126 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002126-25

Protein Description: intercellular adhesion molecule 1
Gene Name: ICAM1
Alternative Gene Name: BB2, CD54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037405: 55%, ENSRNOG00000020679: 49%
Entrez Gene ID: 3383
Uniprot ID: P05362
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSP
• Gene Sequence: EAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSP
• Gene ID - Mouse: ENSMUSG00000037405
• Gene ID - Rat: ENSRNOG00000020679
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ICAM1 pAb (ATL-HPA002126 w/enhanced validation) – 4 Found

Galore-Haskel, Gilli; Nemlich, Yael; Greenberg, Eyal; Ashkenazi, Shira; Hakim, Motti; Itzhaki, Orit; Shoshani, Noa; Shapira-Fromer, Ronnie; Ben-Ami, Eytan; Ofek, Efrat; Anafi, Liat; Besser, Michal J; Schachter, Jacob; Markel, Gal. A novel immune resistance mechanism of melanoma cells controlled by the ADAR1 enzyme. Oncotarget. 2015;6(30):28999-9015. 

Guo, Zhengguang; Wang, Zhao; Lu, Chen; Yang, Shufen; Sun, Haidan; Reziw; Guo, Yu; Sun, Wei; Yue, Hua. Analysis of the differential urinary protein profile in IgA nephropathy patients of Uygur ethnicity. Bmc Nephrology. 2018;19(1):358. 

Bai, Bing; Wang, Xusheng; Li, Yuxin; Chen, Ping-Chung; Yu, Kaiwen; Dey, Kaushik Kumar; Yarbro, Jay M; Han, Xian; Lutz, Brianna M; Rao, Shuquan; Jiao, Yun; Sifford, Jeffrey M; Han, Jonghee; Wang, Minghui; Tan, Haiyan; Shaw, Timothy I; Cho, Ji-Hoon; Zhou, Suiping; Wang, Hong; Niu, Mingming; Mancieri, Ariana; Messler, Kaitlynn A; Sun, Xiaojun; Wu, Zhiping; Pagala, Vishwajeeth; High, Anthony A; Bi, Wenjian; Zhang, Hui; Chi, Hongbo; Haroutunian, Vahram; Zhang, Bin; Beach, Thomas G; Yu, Gang; Peng, Junmin. Deep Multilayer Brain Proteomics Identifies Molecular Networks in Alzheimer's Disease Progression. Neuron. 2020;105(6):975-991.e7. 

Wanschel, Amarylis C B A; Guizoni, Daniele M; Lorza-Gil, Estela; Salerno, Alessandro G; Paiva, Adriene A; Dorighello, Gabriel G; Davel, Ana Paula; Balkan, Wayne; Hare, Joshua M; Oliveira, Helena C F. The Presence of Cholesteryl Ester Transfer Protein (CETP) in Endothelial Cells Generates Vascular Oxidative Stress and Endothelial Dysfunction. Biomolecules. 2021;11(1)