Anti ICAM1 pAb (ATL-HPA002126 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002126-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: ICAM1
Alternative Gene Name: BB2, CD54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037405: 55%, ENSRNOG00000020679: 49%
Entrez Gene ID: 3383
Uniprot ID: P05362
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSP |
| Gene Sequence | EAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSP |
| Gene ID - Mouse | ENSMUSG00000037405 |
| Gene ID - Rat | ENSRNOG00000020679 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ICAM1 pAb (ATL-HPA002126 w/enhanced validation) | |
| Datasheet | Anti ICAM1 pAb (ATL-HPA002126 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ICAM1 pAb (ATL-HPA002126 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ICAM1 pAb (ATL-HPA002126 w/enhanced validation) | |
| Datasheet | Anti ICAM1 pAb (ATL-HPA002126 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ICAM1 pAb (ATL-HPA002126 w/enhanced validation) |
| Citations for Anti ICAM1 pAb (ATL-HPA002126 w/enhanced validation) – 4 Found |
| Galore-Haskel, Gilli; Nemlich, Yael; Greenberg, Eyal; Ashkenazi, Shira; Hakim, Motti; Itzhaki, Orit; Shoshani, Noa; Shapira-Fromer, Ronnie; Ben-Ami, Eytan; Ofek, Efrat; Anafi, Liat; Besser, Michal J; Schachter, Jacob; Markel, Gal. A novel immune resistance mechanism of melanoma cells controlled by the ADAR1 enzyme. Oncotarget. 2015;6(30):28999-9015. PubMed |
| Guo, Zhengguang; Wang, Zhao; Lu, Chen; Yang, Shufen; Sun, Haidan; Reziw; Guo, Yu; Sun, Wei; Yue, Hua. Analysis of the differential urinary protein profile in IgA nephropathy patients of Uygur ethnicity. Bmc Nephrology. 2018;19(1):358. PubMed |
| Bai, Bing; Wang, Xusheng; Li, Yuxin; Chen, Ping-Chung; Yu, Kaiwen; Dey, Kaushik Kumar; Yarbro, Jay M; Han, Xian; Lutz, Brianna M; Rao, Shuquan; Jiao, Yun; Sifford, Jeffrey M; Han, Jonghee; Wang, Minghui; Tan, Haiyan; Shaw, Timothy I; Cho, Ji-Hoon; Zhou, Suiping; Wang, Hong; Niu, Mingming; Mancieri, Ariana; Messler, Kaitlynn A; Sun, Xiaojun; Wu, Zhiping; Pagala, Vishwajeeth; High, Anthony A; Bi, Wenjian; Zhang, Hui; Chi, Hongbo; Haroutunian, Vahram; Zhang, Bin; Beach, Thomas G; Yu, Gang; Peng, Junmin. Deep Multilayer Brain Proteomics Identifies Molecular Networks in Alzheimer's Disease Progression. Neuron. 2020;105(6):975-991.e7. PubMed |
| Wanschel, Amarylis C B A; Guizoni, Daniele M; Lorza-Gil, Estela; Salerno, Alessandro G; Paiva, Adriene A; Dorighello, Gabriel G; Davel, Ana Paula; Balkan, Wayne; Hare, Joshua M; Oliveira, Helena C F. The Presence of Cholesteryl Ester Transfer Protein (CETP) in Endothelial Cells Generates Vascular Oxidative Stress and Endothelial Dysfunction. Biomolecules. 2021;11(1) PubMed |