Anti HUNK pAb (ATL-HPA027372)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027372-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HUNK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053414: 86%, ENSRNOG00000002092: 86%
Entrez Gene ID: 30811
Uniprot ID: P57058
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NSPVSLACRNSSERTLSPGLPSGSMSPLHTPLHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIG |
| Gene Sequence | NSPVSLACRNSSERTLSPGLPSGSMSPLHTPLHPTLVSFAHEDKNSPPKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIG |
| Gene ID - Mouse | ENSMUSG00000053414 |
| Gene ID - Rat | ENSRNOG00000002092 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HUNK pAb (ATL-HPA027372) | |
| Datasheet | Anti HUNK pAb (ATL-HPA027372) Datasheet (External Link) |
| Vendor Page | Anti HUNK pAb (ATL-HPA027372) at Atlas Antibodies |
| Documents & Links for Anti HUNK pAb (ATL-HPA027372) | |
| Datasheet | Anti HUNK pAb (ATL-HPA027372) Datasheet (External Link) |
| Vendor Page | Anti HUNK pAb (ATL-HPA027372) |