Anti HSPA4 pAb (ATL-HPA010023)

Atlas Antibodies

Catalog No.: ATL-HPA010023-25

Protein Description: heat shock 70kDa protein 4
Gene Name: HSPA4
Alternative Gene Name: HS24/P52, HSPH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020361: 92%, ENSRNOG00000016596: 92%
Entrez Gene ID: 3308
Uniprot ID: P34932
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDG
• Gene Sequence: FEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDG
• Gene ID - Mouse: ENSMUSG00000020361
• Gene ID - Rat: ENSRNOG00000016596
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HSPA4 pAb (ATL-HPA010023) – 3 Found

Li, Sung-Chou; Lan, Kuo-Chung; Hung, Hsuan-Ning; Huang, Wan-Ting; Lai, Yun-Ju; Cheng, Hsin-Hsin; Tsai, Chih-Chang; Huang, Kun-Long; You, Huey-Ling; Hsu, Te-Yao. HSPA4 Is a Biomarker of Placenta Accreta and Enhances the Angiogenesis Ability of Vessel Endothelial Cells. International Journal Of Molecular Sciences. 2022;23(10) 

Morisaki, Tamami; Yashiro, Masakazu; Kakehashi, Anna; Inagaki, Azusa; Kinoshita, Haruhito; Fukuoka, Tatsunari; Kasashima, Hiroaki; Masuda, Go; Sakurai, Katsunobu; Kubo, Naoshi; Muguruma, Kazuya; Ohira, Masaichi; Wanibuchi, Hideki; Hirakawa, Kosei. Comparative proteomics analysis of gastric cancer stem cells. Plos One. 9(11):e110736. 

Bourdeaux, Florian; Kopp, Yannick; Lautenschläger, Julia; Gößner, Ines; Besir, Hüseyin; Vabulas, R Martin; Grininger, Martin. Dodecin as carrier protein for immunizations and bioengineering applications. Scientific Reports. 2020;10(1):13297.