Anti HSPA2 pAb (ATL-HPA000798 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000798-25

Protein Description: heat shock 70kDa protein 2
Gene Name: HSPA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059970: 95%, ENSRNOG00000006472: 95%
Entrez Gene ID: 3306
Uniprot ID: P54652
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEE
• Gene Sequence: ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEE
• Gene ID - Mouse: ENSMUSG00000059970
• Gene ID - Rat: ENSRNOG00000006472
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HSPA2 pAb (ATL-HPA000798 w/enhanced validation) – 8 Found

Scieglinska, Dorota; Krawczyk, Zdzislaw. Expression, function, and regulation of the testis-enriched heat shock HSPA2 gene in rodents and humans. Cell Stress & Chaperones. 2015;20(2):221-35. 

Unger, Andreas; Beckendorf, Lisa; Böhme, Pierre; Kley, Rudolf; von Frieling-Salewsky, Marion; Lochmüller, Hanns; Schröder, Rolf; Fürst, Dieter O; Vorgerd, Matthias; Linke, Wolfgang A. Translocation of molecular chaperones to the titin springs is common in skeletal myopathy patients and affects sarcomere function. Acta Neuropathologica Communications. 2017;5(1):72. 

Mulder, J; Wernérus, H; Shi, T-J; Pontén, F; Hober, S; Uhlén, M; Hökfelt, T. Systematically generated antibodies against human gene products: high throughput screening on sections from the rat nervous system. Neuroscience. 2007;146(4):1689-703. 

Grad, Iwona; Cederroth, Christopher R; Walicki, Joël; Grey, Corinne; Barluenga, Sofia; Winssinger, Nicolas; De Massy, Bernard; Nef, Serge; Picard, Didier. The molecular chaperone Hsp90α is required for meiotic progression of spermatocytes beyond pachytene in the mouse. Plos One. 2010;5(12):e15770. 

Rogon, Christian; Ulbricht, Anna; Hesse, Michael; Alberti, Simon; Vijayaraj, Preethi; Best, Diana; Adams, Ian R; Magin, Thomas M; Fleischmann, Bernd K; Höhfeld, Jörg. HSP70-binding protein HSPBP1 regulates chaperone expression at a posttranslational level and is essential for spermatogenesis. Molecular Biology Of The Cell. 2014;25(15):2260-71. 

Bao, Xinjie; Wang, Gengchao; Yu, Shan; Sun, Jian; He, Liu; Zhao, Hualu; Ma, Yanni; Wang, Fang; Wang, Xiaoshuang; Wang, Renzhi; Yu, Jia. Transcriptomic analysis identifies a tumor subtype mRNA classifier for invasive non-functioning pituitary neuroendocrine tumor diagnostics. Theranostics. 11(1):132-146. 

Pei, J; Schuldt, M; Nagyova, E; Gu, Z; El Bouhaddani, S; Yiangou, L; Jansen, M; Calis, J J A; Dorsch, L M; Blok, C Snijders; van den Dungen, N A M; Lansu, N; Boukens, B J; Efimov, I R; Michels, M; Verhaar, M C; de Weger, R; Vink, A; van Steenbeek, F G; Baas, A F; Davis, R P; Uh, H W; Kuster, D W D; Cheng, C; Mokry, M; van der Velden, J; Asselbergs, F W; Harakalova, M. Multi-omics integration identifies key upstream regulators of pathomechanisms in hypertrophic cardiomyopathy due to truncating MYBPC3 mutations. Clinical Epigenetics. 2021;13(1):61. 

Stein, Daniel; Slobodnik, Zeev; Tam, Benjamin; Einav, Monica; Akabayov, Barak; Berstein, Shimon; Toiber, Debra. 4-phenylbutyric acid-Identity crisis; can it act as a translation inhibitor?. Aging Cell. 2022;21(12):e13738.