Anti HSD17B12 pAb (ATL-HPA016427)

Atlas Antibodies

Catalog No.: ATL-HPA016427-25

Protein Description: hydroxysteroid (17-beta) dehydrogenase 12
Gene Name: HSD17B12
Alternative Gene Name: KAR, SDR12C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027195: 83%, ENSRNOG00000009630: 83%
Entrez Gene ID: 51144
Uniprot ID: Q53GQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKTGLAGLEIGILVNNVGMSYEYPEYFLDVPDLD
• Gene Sequence: WGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKTGLAGLEIGILVNNVGMSYEYPEYFLDVPDLD
• Gene ID - Mouse: ENSMUSG00000027195
• Gene ID - Rat: ENSRNOG00000009630
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HSD17B12 pAb (ATL-HPA016427) – 1 Found

Tsachaki, Maria; Strauss, Pirmin; Dunkel, Anja; Navrátilová, Hana; Mladenovic, Natasa; Odermatt, Alex. Impact of 17β-HSD12, the 3-ketoacyl-CoA reductase of long-chain fatty acid synthesis, on breast cancer cell proliferation and migration. Cellular And Molecular Life Sciences : Cmls. 2020;77(6):1153-1175.