Anti HSCB pAb (ATL-HPA031518)

Atlas Antibodies

Catalog No.: ATL-HPA031518-25

Protein Description: HscB mitochondrial iron-sulfur cluster co-chaperone
Gene Name: HSCB
Alternative Gene Name: DNAJC20, HSC20, Jac1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043510: 85%, ENSRNOG00000037508: 84%
Entrez Gene ID: 150274
Uniprot ID: Q8IWL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEM
• Gene Sequence: DCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEM
• Gene ID - Mouse: ENSMUSG00000043510
• Gene ID - Rat: ENSRNOG00000037508
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.