Anti HS1BP3 pAb (ATL-HPA035050)

Atlas Antibodies

Catalog No.:
ATL-HPA035050-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HCLS1 binding protein 3
Gene Name: HS1BP3
Alternative Gene Name: FLJ14249, HS1-BP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020605: 78%, ENSRNOG00000006062: 77%
Entrez Gene ID: 64342
Uniprot ID: Q53T59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAE
Gene Sequence LFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAE
Gene ID - Mouse ENSMUSG00000020605
Gene ID - Rat ENSRNOG00000006062
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HS1BP3 pAb (ATL-HPA035050)
Datasheet Anti HS1BP3 pAb (ATL-HPA035050) Datasheet (External Link)
Vendor Page Anti HS1BP3 pAb (ATL-HPA035050) at Atlas Antibodies

Documents & Links for Anti HS1BP3 pAb (ATL-HPA035050)
Datasheet Anti HS1BP3 pAb (ATL-HPA035050) Datasheet (External Link)
Vendor Page Anti HS1BP3 pAb (ATL-HPA035050)