Anti HRNR pAb (ATL-HPA031469)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031469-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: HRNR
Alternative Gene Name: FLG3, S100A16, S100a18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049133: 38%, ENSRNOG00000053250: 41%
Entrez Gene ID: 388697
Uniprot ID: Q86YZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS |
| Gene Sequence | WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS |
| Gene ID - Mouse | ENSMUSG00000049133 |
| Gene ID - Rat | ENSRNOG00000053250 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HRNR pAb (ATL-HPA031469) | |
| Datasheet | Anti HRNR pAb (ATL-HPA031469) Datasheet (External Link) |
| Vendor Page | Anti HRNR pAb (ATL-HPA031469) at Atlas Antibodies |
| Documents & Links for Anti HRNR pAb (ATL-HPA031469) | |
| Datasheet | Anti HRNR pAb (ATL-HPA031469) Datasheet (External Link) |
| Vendor Page | Anti HRNR pAb (ATL-HPA031469) |
| Citations for Anti HRNR pAb (ATL-HPA031469) – 1 Found |
| Gutknecht, Michael F; Seaman, Marc E; Ning, Bo; Cornejo, Daniel Auger; Mugler, Emily; Antkowiak, Patrick F; Moskaluk, Christopher A; Hu, Song; Epstein, Frederick H; Kelly, Kimberly A. Identification of the S100 fused-type protein hornerin as a regulator of tumor vascularity. Nature Communications. 2017;8(1):552. PubMed |