Anti HRH2 pAb (ATL-HPA013770)

Atlas Antibodies

Catalog No.:
ATL-HPA013770-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: histamine receptor H2
Gene Name: HRH2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034987: 75%, ENSRNOG00000018260: 72%
Entrez Gene ID: 3274
Uniprot ID: P25021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Gene Sequence NRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Gene ID - Mouse ENSMUSG00000034987
Gene ID - Rat ENSRNOG00000018260
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HRH2 pAb (ATL-HPA013770)
Datasheet Anti HRH2 pAb (ATL-HPA013770) Datasheet (External Link)
Vendor Page Anti HRH2 pAb (ATL-HPA013770) at Atlas Antibodies

Documents & Links for Anti HRH2 pAb (ATL-HPA013770)
Datasheet Anti HRH2 pAb (ATL-HPA013770) Datasheet (External Link)
Vendor Page Anti HRH2 pAb (ATL-HPA013770)