Anti HRH2 pAb (ATL-HPA013770)
Atlas Antibodies
- Catalog No.:
- ATL-HPA013770-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HRH2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034987: 75%, ENSRNOG00000018260: 72%
Entrez Gene ID: 3274
Uniprot ID: P25021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR |
| Gene Sequence | NRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR |
| Gene ID - Mouse | ENSMUSG00000034987 |
| Gene ID - Rat | ENSRNOG00000018260 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HRH2 pAb (ATL-HPA013770) | |
| Datasheet | Anti HRH2 pAb (ATL-HPA013770) Datasheet (External Link) |
| Vendor Page | Anti HRH2 pAb (ATL-HPA013770) at Atlas Antibodies |
| Documents & Links for Anti HRH2 pAb (ATL-HPA013770) | |
| Datasheet | Anti HRH2 pAb (ATL-HPA013770) Datasheet (External Link) |
| Vendor Page | Anti HRH2 pAb (ATL-HPA013770) |