Anti HPS6 pAb (ATL-HPA040687)

Atlas Antibodies

Catalog No.:
ATL-HPA040687-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Hermansky-Pudlak syndrome 6
Gene Name: HPS6
Alternative Gene Name: FLJ22501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074811: 88%, ENSRNOG00000018433: 89%
Entrez Gene ID: 79803
Uniprot ID: Q86YV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TRGNLRLLSALGLFCVGWEAPQGVELPSAKDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTM
Gene Sequence TRGNLRLLSALGLFCVGWEAPQGVELPSAKDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTM
Gene ID - Mouse ENSMUSG00000074811
Gene ID - Rat ENSRNOG00000018433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HPS6 pAb (ATL-HPA040687)
Datasheet Anti HPS6 pAb (ATL-HPA040687) Datasheet (External Link)
Vendor Page Anti HPS6 pAb (ATL-HPA040687) at Atlas Antibodies

Documents & Links for Anti HPS6 pAb (ATL-HPA040687)
Datasheet Anti HPS6 pAb (ATL-HPA040687) Datasheet (External Link)
Vendor Page Anti HPS6 pAb (ATL-HPA040687)