Anti HPRT1 pAb (ATL-HPA006360 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006360-25

Protein Description: hypoxanthine phosphoribosyltransferase 1
Gene Name: HPRT1
Alternative Gene Name: HGPRT, HPRT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025630: 98%, ENSRNOG00000048561: 98%
Entrez Gene ID: 3251
Uniprot ID: P00492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMV
• Gene Sequence: SDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMV
• Gene ID - Mouse: ENSMUSG00000025630
• Gene ID - Rat: ENSRNOG00000048561
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HPRT1 pAb (ATL-HPA006360 w/enhanced validation) – 3 Found

Bruun, Gitte H; Doktor, Thomas K; Borch-Jensen, Jonas; Masuda, Akio; Krainer, Adrian R; Ohno, Kinji; Andresen, Brage S. Global identification of hnRNP A1 binding sites for SSO-based splicing modulation. Bmc Biology. 2016;14( 27380775):54. 

Bruun, Gitte H; Bang, Jeanne M V; Christensen, Lise L; Brøner, Sabrina; Petersen, Ulrika S S; Guerra, Barbara; Grønning, Alexander G B; Doktor, Thomas K; Andresen, Brage S. Blocking of an intronic splicing silencer completely rescues IKBKAP exon 20 splicing in familial dysautonomia patient cells. Nucleic Acids Research. 2018;46(15):7938-7952. 

Grønning, Alexander Gulliver Bjørnholt; Doktor, Thomas Koed; Larsen, Simon Jonas; Petersen, Ulrika Simone Spangsberg; Holm, Lise Lolle; Bruun, Gitte Hoffmann; Hansen, Michael Birkerod; Hartung, Anne-Mette; Baumbach, Jan; Andresen, Brage Storstein. DeepCLIP: predicting the effect of mutations on protein-RNA binding with deep learning. Nucleic Acids Research. 2020;48(13):7099-7118.