Anti HPGDS pAb (ATL-HPA024035)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024035-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HPGDS
Alternative Gene Name: GSTS, GSTS1-1, H-PGDS, PGD2, PGDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029919: 73%, ENSRNOG00000006583: 73%
Entrez Gene ID: 27306
Uniprot ID: O60760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI |
Gene Sequence | KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI |
Gene ID - Mouse | ENSMUSG00000029919 |
Gene ID - Rat | ENSRNOG00000006583 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HPGDS pAb (ATL-HPA024035) | |
Datasheet | Anti HPGDS pAb (ATL-HPA024035) Datasheet (External Link) |
Vendor Page | Anti HPGDS pAb (ATL-HPA024035) at Atlas Antibodies |
Documents & Links for Anti HPGDS pAb (ATL-HPA024035) | |
Datasheet | Anti HPGDS pAb (ATL-HPA024035) Datasheet (External Link) |
Vendor Page | Anti HPGDS pAb (ATL-HPA024035) |