Anti HPGDS pAb (ATL-HPA024035)

Atlas Antibodies

Catalog No.:
ATL-HPA024035-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: hematopoietic prostaglandin D synthase
Gene Name: HPGDS
Alternative Gene Name: GSTS, GSTS1-1, H-PGDS, PGD2, PGDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029919: 73%, ENSRNOG00000006583: 73%
Entrez Gene ID: 27306
Uniprot ID: O60760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI
Gene Sequence KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI
Gene ID - Mouse ENSMUSG00000029919
Gene ID - Rat ENSRNOG00000006583
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HPGDS pAb (ATL-HPA024035)
Datasheet Anti HPGDS pAb (ATL-HPA024035) Datasheet (External Link)
Vendor Page Anti HPGDS pAb (ATL-HPA024035) at Atlas Antibodies

Documents & Links for Anti HPGDS pAb (ATL-HPA024035)
Datasheet Anti HPGDS pAb (ATL-HPA024035) Datasheet (External Link)
Vendor Page Anti HPGDS pAb (ATL-HPA024035)