Anti HPF1 pAb (ATL-HPA043467)

Atlas Antibodies

Catalog No.:
ATL-HPA043467-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: histone PARylation factor 1
Gene Name: HPF1
Alternative Gene Name: C4orf27, FLJ20534
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038005: 92%, ENSRNOG00000011293: 91%
Entrez Gene ID: 54969
Uniprot ID: Q9NWY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQYHMGYFRDSPDEFPVYVGINEAKKNCIIVPNGDNVFAA
Gene Sequence LVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQYHMGYFRDSPDEFPVYVGINEAKKNCIIVPNGDNVFAA
Gene ID - Mouse ENSMUSG00000038005
Gene ID - Rat ENSRNOG00000011293
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HPF1 pAb (ATL-HPA043467)
Datasheet Anti HPF1 pAb (ATL-HPA043467) Datasheet (External Link)
Vendor Page Anti HPF1 pAb (ATL-HPA043467) at Atlas Antibodies

Documents & Links for Anti HPF1 pAb (ATL-HPA043467)
Datasheet Anti HPF1 pAb (ATL-HPA043467) Datasheet (External Link)
Vendor Page Anti HPF1 pAb (ATL-HPA043467)
Citations for Anti HPF1 pAb (ATL-HPA043467) – 2 Found
Huang, Dan; Camacho, Cristel V; Setlem, Rohit; Ryu, Keun Woo; Parameswaran, Balaji; Gupta, Rana K; Kraus, W Lee. Functional Interplay between Histone H2B ADP-Ribosylation and Phosphorylation Controls Adipogenesis. Molecular Cell. 2020;79(6):934-949.e14.  PubMed
Mosler, Thorsten; Baymaz, H Irem; Gräf, Justus F; Mikicic, Ivan; Blattner, Georges; Bartlett, Edward; Ostermaier, Matthias; Piccinno, Rossana; Yang, Jiwen; Voigt, Andrea; Gatti, Marco; Pellegrino, Stefania; Altmeyer, Matthias; Luck, Katja; Ahel, Ivan; Roukos, Vassilis; Beli, Petra. PARP1 proximity proteomics reveals interaction partners at stressed replication forks. Nucleic Acids Research. 2022;50(20):11600-11618.  PubMed