Anti HP pAb (ATL-HPA047750)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047750-100
- Shipping:
- Calculated at Checkout
$486.00
Gene Name: HP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031722: 81%, ENSRNOG00000014964: 83%
Entrez Gene ID: 3240
Uniprot ID: P00738
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVG |
Gene Sequence | GKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVG |
Gene ID - Mouse | ENSMUSG00000031722 |
Gene ID - Rat | ENSRNOG00000014964 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HP pAb (ATL-HPA047750) | |
Datasheet | Anti HP pAb (ATL-HPA047750) Datasheet (External Link) |
Vendor Page | Anti HP pAb (ATL-HPA047750) at Atlas Antibodies |
Documents & Links for Anti HP pAb (ATL-HPA047750) | |
Datasheet | Anti HP pAb (ATL-HPA047750) Datasheet (External Link) |
Vendor Page | Anti HP pAb (ATL-HPA047750) |