Anti HOXD4 pAb (ATL-HPA070349)

Atlas Antibodies

Catalog No.:
ATL-HPA070349-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: homeobox D4
Gene Name: HOXD4
Alternative Gene Name: HOX4, HOX4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000101174: 84%, ENSRNOG00000001578: 84%
Entrez Gene ID: 3233
Uniprot ID: P09016
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARAYSQSDPKQPPSGTALKQPAVVYPWMKKV
Gene Sequence ARAYSQSDPKQPPSGTALKQPAVVYPWMKKV
Gene ID - Mouse ENSMUSG00000101174
Gene ID - Rat ENSRNOG00000001578
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HOXD4 pAb (ATL-HPA070349)
Datasheet Anti HOXD4 pAb (ATL-HPA070349) Datasheet (External Link)
Vendor Page Anti HOXD4 pAb (ATL-HPA070349) at Atlas Antibodies

Documents & Links for Anti HOXD4 pAb (ATL-HPA070349)
Datasheet Anti HOXD4 pAb (ATL-HPA070349) Datasheet (External Link)
Vendor Page Anti HOXD4 pAb (ATL-HPA070349)