Anti HOXC5 pAb (ATL-HPA026794)

Atlas Antibodies

Catalog No.: ATL-HPA026794-25

Protein Description: homeobox C5
Gene Name: HOXC5
Alternative Gene Name: HOX3, HOX3D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022485: 98%, ENSRNOG00000016598: 98%
Entrez Gene ID: 3222
Uniprot ID: Q00444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMT
• Gene Sequence: PGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMT
• Gene ID - Mouse: ENSMUSG00000022485
• Gene ID - Rat: ENSRNOG00000016598
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HOXC5 pAb (ATL-HPA026794) – 2 Found

Li, Chung-Jung; Hong, Tian; Tung, Ying-Tsen; Yen, Ya-Ping; Hsu, Ho-Chiang; Lu, Ya-Lin; Chang, Mien; Nie, Qing; Chen, Jun-An. MicroRNA filters Hox temporal transcription noise to confer boundary formation in the spinal cord. Nature Communications. 2017;8( 28337978):14685. 

Yan, TingDong; Ooi, Wen Fong; Qamra, Aditi; Cheung, Alice; Ma, DongLiang; Sundaram, Gopinath Meenakshi; Xu, Chang; Xing, Manjie; Poon, LaiFong; Wang, Jing; Loh, Yan Ping; Ho, Jess Hui Jie; Ng, Joscelyn Jun Quan; Ramlee, Muhammad Khairul; Aswad, Luay; Rozen, Steve G; Ghosh, Sujoy; Bard, Frederic A; Sampath, Prabha; Tergaonkar, Vinay; Davies, James O J; Hughes, Jim R; Goh, Eyleen; Bi, Xuezhi; Fullwood, Melissa Jane; Tan, Patrick; Li, Shang. HoxC5 and miR-615-3p target newly evolved genomic regions to repress hTERT and inhibit tumorigenesis. Nature Communications. 2018;9(1):100.