Anti HOXA5 pAb (ATL-HPA029319 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029319-25

Protein Description: homeobox A5
Gene Name: HOXA5
Alternative Gene Name: HOX1, HOX1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038253: 96%, ENSRNOG00000052804: 96%
Entrez Gene ID: 3202
Uniprot ID: P20719
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDN
• Gene Sequence: MHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDN
• Gene ID - Mouse: ENSMUSG00000038253
• Gene ID - Rat: ENSRNOG00000052804
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HOXA5 pAb (ATL-HPA029319 w/enhanced validation) – 4 Found

Li, Chung-Jung; Hong, Tian; Tung, Ying-Tsen; Yen, Ya-Ping; Hsu, Ho-Chiang; Lu, Ya-Lin; Chang, Mien; Nie, Qing; Chen, Jun-An. MicroRNA filters Hox temporal transcription noise to confer boundary formation in the spinal cord. Nature Communications. 2017;8( 28337978):14685. 

Gjyshi, Anxhela; Dash, Sweta; Cen, Ling; Cheng, Chia-Ho; Zhang, Chaomei; Yoder, Sean J; Teer, Jamie K; Armaiz-Pena, Guillermo N; Monteiro, Alvaro N A. Early transcriptional response of human ovarian and fallopian tube surface epithelial cells to norepinephrine. Scientific Reports. 2018;8(1):8291. 

Liao, Yadi; Wang, Chenwei; Yang, Zhiwen; Liu, Wenwu; Yuan, Yichuan; Li, Kai; Zhang, Yuanping; Wang, Yongjin; Shi, Yunxing; Qiu, Yuxiong; Zuo, Dinglan; He, Wei; Qiu, Jiliang; Guan, Xinyuan; Yuan, Yunfei; Li, Binkui. Dysregulated Sp1/miR-130b-3p/HOXA5 axis contributes to tumor angiogenesis and progression of hepatocellular carcinoma. Theranostics. 10(12):5209-5224. 

Xiong, Fei; Liu, Wenzheng; Wang, Xin; Wu, Guanhua; Wang, Qi; Guo, Tong; Huang, Wenhua; Wang, Bing; Chen, Yongjun. HOXA5 inhibits the proliferation of extrahepatic cholangiocarcinoma cells by enhancing MXD1 expression and activating the p53 pathway. Cell Death & Disease. 2022;13(9):829.