Anti HORMAD2 pAb (ATL-HPA043880)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043880-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: HORMAD2
Alternative Gene Name: CT46.2, MGC26710
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020419: 64%, ENSRNOG00000037865: 50%
Entrez Gene ID: 150280
Uniprot ID: Q8N7B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SHFLLFDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFVCSQQSSECSRKK |
| Gene Sequence | SHFLLFDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFVCSQQSSECSRKK |
| Gene ID - Mouse | ENSMUSG00000020419 |
| Gene ID - Rat | ENSRNOG00000037865 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HORMAD2 pAb (ATL-HPA043880) | |
| Datasheet | Anti HORMAD2 pAb (ATL-HPA043880) Datasheet (External Link) |
| Vendor Page | Anti HORMAD2 pAb (ATL-HPA043880) at Atlas Antibodies |
| Documents & Links for Anti HORMAD2 pAb (ATL-HPA043880) | |
| Datasheet | Anti HORMAD2 pAb (ATL-HPA043880) Datasheet (External Link) |
| Vendor Page | Anti HORMAD2 pAb (ATL-HPA043880) |