Anti HORMAD2 pAb (ATL-HPA043880)

Atlas Antibodies

Catalog No.:
ATL-HPA043880-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: HORMA domain containing 2
Gene Name: HORMAD2
Alternative Gene Name: CT46.2, MGC26710
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020419: 64%, ENSRNOG00000037865: 50%
Entrez Gene ID: 150280
Uniprot ID: Q8N7B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHFLLFDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFVCSQQSSECSRKK
Gene Sequence SHFLLFDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFVCSQQSSECSRKK
Gene ID - Mouse ENSMUSG00000020419
Gene ID - Rat ENSRNOG00000037865
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HORMAD2 pAb (ATL-HPA043880)
Datasheet Anti HORMAD2 pAb (ATL-HPA043880) Datasheet (External Link)
Vendor Page Anti HORMAD2 pAb (ATL-HPA043880) at Atlas Antibodies

Documents & Links for Anti HORMAD2 pAb (ATL-HPA043880)
Datasheet Anti HORMAD2 pAb (ATL-HPA043880) Datasheet (External Link)
Vendor Page Anti HORMAD2 pAb (ATL-HPA043880)