Anti HORMAD1 pAb (ATL-HPA037850 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037850-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: HORMAD1
Alternative Gene Name: CT46, DKFZP434A1315
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028109: 63%, ENSRNOG00000021160: 68%
Entrez Gene ID: 84072
Uniprot ID: Q86X24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSESKTRSGKVFQNKMANGNQPVKSSKENRKRSQHESGRIVLHHFDSSSQESVPKRRKFSEPK |
| Gene Sequence | MSESKTRSGKVFQNKMANGNQPVKSSKENRKRSQHESGRIVLHHFDSSSQESVPKRRKFSEPK |
| Gene ID - Mouse | ENSMUSG00000028109 |
| Gene ID - Rat | ENSRNOG00000021160 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HORMAD1 pAb (ATL-HPA037850 w/enhanced validation) | |
| Datasheet | Anti HORMAD1 pAb (ATL-HPA037850 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HORMAD1 pAb (ATL-HPA037850 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HORMAD1 pAb (ATL-HPA037850 w/enhanced validation) | |
| Datasheet | Anti HORMAD1 pAb (ATL-HPA037850 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HORMAD1 pAb (ATL-HPA037850 w/enhanced validation) |
| Citations for Anti HORMAD1 pAb (ATL-HPA037850 w/enhanced validation) – 6 Found |
| Watkins, Johnathan; Weekes, Daniel; Shah, Vandna; Gazinska, Patrycja; Joshi, Shalaka; Sidhu, Bhavna; Gillett, Cheryl; Pinder, Sarah; Vanoli, Fabio; Jasin, Maria; Mayrhofer, Markus; Isaksson, Anders; Cheang, Maggie C U; Mirza, Hasan; Frankum, Jessica; Lord, Christopher J; Ashworth, Alan; Vinayak, Shaveta; Ford, James M; Telli, Melinda L; Grigoriadis, Anita; Tutt, Andrew N J. Genomic Complexity Profiling Reveals That HORMAD1 Overexpression Contributes to Homologous Recombination Deficiency in Triple-Negative Breast Cancers. Cancer Discovery. 2015;5(5):488-505. PubMed |
| Djureinovic, Dijana; Hallström, Björn M; Horie, Masafumi; Mattsson, Johanna Sofia Margareta; La Fleur, Linnea; Fagerberg, Linn; Brunnström, Hans; Lindskog, Cecilia; Madjar, Katrin; Rahnenführer, Jörg; Ekman, Simon; Ståhle, Elisabeth; Koyi, Hirsh; Brandén, Eva; Edlund, Karolina; Hengstler, Jan G; Lambe, Mats; Saito, Akira; Botling, Johan; Pontén, Fredrik; Uhlén, Mathias; Micke, Patrick. Profiling cancer testis antigens in non-small-cell lung cancer. Jci Insight. 2016;1(10):e86837. PubMed |
| Wang, Xian; Tan, Ying; Cao, Xixi; Kim, Jin Ah; Chen, Tianmeng; Hu, Yiheng; Wexler, Matthew; Wang, Xiaosong. Epigenetic activation of HORMAD1 in basal-like breast cancer: role in Rucaparib sensitivity. Oncotarget. 2018;9(53):30115-30127. PubMed |
| Zong, Beige; Sun, Lu; Peng, Yang; Wang, Yihua; Yu, Yu; Lei, Jinwei; Zhang, Yingzi; Guo, Shipeng; Li, Kang; Liu, Shengchun. HORMAD1 promotes docetaxel resistance in triple negative breast cancer by enhancing DNA damage tolerance. Oncology Reports. 2021;46(1) PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Nichols, Brandt A; Oswald, Nathaniel W; McMillan, Elizabeth A; McGlynn, Kathleen; Yan, Jingsheng; Kim, Min S; Saha, Janapriya; Mallipeddi, Prema L; LaDuke, Sydnie A; Villalobos, Pamela A; Rodriguez-Canales, Jaime; Wistuba, Ignacio I; Posner, Bruce A; Davis, Anthony J; Minna, John D; MacMillan, John B; Whitehurst, Angelique W. HORMAD1 Is a Negative Prognostic Indicator in Lung Adenocarcinoma and Specifies Resistance to Oxidative and Genotoxic Stress. Cancer Research. 2018;78(21):6196-6208. PubMed |