Anti HORMAD1 pAb (ATL-HPA028346)

Atlas Antibodies

Catalog No.:
ATL-HPA028346-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: HORMA domain containing 1
Gene Name: HORMAD1
Alternative Gene Name: CT46, DKFZP434A1315
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028109: 50%, ENSRNOG00000021160: 47%
Entrez Gene ID: 84072
Uniprot ID: Q86X24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKDVEDEQEHYTSDDLDIETKMEEQEKNPASSELEEPSLVCEEDEIMRSKESPDLSISHSQVEQLVNK
Gene Sequence DKDVEDEQEHYTSDDLDIETKMEEQEKNPASSELEEPSLVCEEDEIMRSKESPDLSISHSQVEQLVNK
Gene ID - Mouse ENSMUSG00000028109
Gene ID - Rat ENSRNOG00000021160
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HORMAD1 pAb (ATL-HPA028346)
Datasheet Anti HORMAD1 pAb (ATL-HPA028346) Datasheet (External Link)
Vendor Page Anti HORMAD1 pAb (ATL-HPA028346) at Atlas Antibodies

Documents & Links for Anti HORMAD1 pAb (ATL-HPA028346)
Datasheet Anti HORMAD1 pAb (ATL-HPA028346) Datasheet (External Link)
Vendor Page Anti HORMAD1 pAb (ATL-HPA028346)