Anti HORMAD1 pAb (ATL-HPA028346)

Atlas Antibodies

Catalog No.: ATL-HPA028346-25

Protein Description: HORMA domain containing 1
Gene Name: HORMAD1
Alternative Gene Name: CT46, DKFZP434A1315
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028109: 50%, ENSRNOG00000021160: 47%
Entrez Gene ID: 84072
Uniprot ID: Q86X24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKDVEDEQEHYTSDDLDIETKMEEQEKNPASSELEEPSLVCEEDEIMRSKESPDLSISHSQVEQLVNK
• Gene Sequence: DKDVEDEQEHYTSDDLDIETKMEEQEKNPASSELEEPSLVCEEDEIMRSKESPDLSISHSQVEQLVNK
• Gene ID - Mouse: ENSMUSG00000028109
• Gene ID - Rat: ENSRNOG00000021160
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.