Anti HORMAD1 pAb (ATL-HPA028346)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028346-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HORMAD1
Alternative Gene Name: CT46, DKFZP434A1315
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028109: 50%, ENSRNOG00000021160: 47%
Entrez Gene ID: 84072
Uniprot ID: Q86X24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DKDVEDEQEHYTSDDLDIETKMEEQEKNPASSELEEPSLVCEEDEIMRSKESPDLSISHSQVEQLVNK |
| Gene Sequence | DKDVEDEQEHYTSDDLDIETKMEEQEKNPASSELEEPSLVCEEDEIMRSKESPDLSISHSQVEQLVNK |
| Gene ID - Mouse | ENSMUSG00000028109 |
| Gene ID - Rat | ENSRNOG00000021160 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HORMAD1 pAb (ATL-HPA028346) | |
| Datasheet | Anti HORMAD1 pAb (ATL-HPA028346) Datasheet (External Link) |
| Vendor Page | Anti HORMAD1 pAb (ATL-HPA028346) at Atlas Antibodies |
| Documents & Links for Anti HORMAD1 pAb (ATL-HPA028346) | |
| Datasheet | Anti HORMAD1 pAb (ATL-HPA028346) Datasheet (External Link) |
| Vendor Page | Anti HORMAD1 pAb (ATL-HPA028346) |