Anti HOOK3 pAb (ATL-HPA024756 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024756-25

Protein Description: hook microtubule-tethering protein 3
Gene Name: HOOK3
Alternative Gene Name: HK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037234: 99%, ENSRNOG00000026226: 58%
Entrez Gene ID: 84376
Uniprot ID: Q86VS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEEIAQRCHELDMQVAALQEEKSSLLAENQVLMERLNQSDSIEDPNSPAGRRHLQLQTQLEQLQEETFRLEA
• Gene Sequence: KEEIAQRCHELDMQVAALQEEKSSLLAENQVLMERLNQSDSIEDPNSPAGRRHLQLQTQLEQLQEETFRLEA
• Gene ID - Mouse: ENSMUSG00000037234
• Gene ID - Rat: ENSRNOG00000026226
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HOOK3 pAb (ATL-HPA024756 w/enhanced validation) – 1 Found

Melling, Nathaniel; Harutyunyan, Levon; Hube-Magg, Claudia; Kluth, Martina; Simon, Ronald; Lebok, Patrick; Minner, Sarah; Tsourlakis, Maria Christina; Koop, Christina; Graefen, Markus; Adam, Meike; Haese, Alexander; Wittmer, Corinna; Steurer, Stefan; Izbicki, Jakob; Sauter, Guido; Wilczak, Waldemar; Schlomm, Thorsten; Krech, Till. High-Level HOOK3 Expression Is an Independent Predictor of Poor Prognosis Associated with Genomic Instability in Prostate Cancer. Plos One. 10(7):e0134614.