Anti HOMER2 pAb (ATL-HPA040134)

Atlas Antibodies

Catalog No.: ATL-HPA040134-25

Protein Description: homer homolog 2 (Drosophila)
Gene Name: HOMER2
Alternative Gene Name: CPD, Cupidin, HOMER-2, HOMER-2A, HOMER-2B, Vesl-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025813: 99%, ENSRNOG00000061450: 99%
Entrez Gene ID: 9455
Uniprot ID: Q9NSB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
• Gene Sequence: IIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
• Gene ID - Mouse: ENSMUSG00000025813
• Gene ID - Rat: ENSRNOG00000061450
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.