Anti HOGA1 pAb (ATL-HPA039466)

Atlas Antibodies

Catalog No.: ATL-HPA039466-25

Protein Description: 4-hydroxy-2-oxoglutarate aldolase 1
Gene Name: HOGA1
Alternative Gene Name: C10orf65, DHDPS2, DHDPSL, FLJ37472, NPL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025176: 89%, ENSRNOG00000029501: 90%
Entrez Gene ID: 112817
Uniprot ID: Q86XE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCYYRGRMSS
• Gene Sequence: NGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCYYRGRMSS
• Gene ID - Mouse: ENSMUSG00000025176
• Gene ID - Rat: ENSRNOG00000029501
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.