Anti HOGA1 pAb (ATL-HPA039466)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039466-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HOGA1
Alternative Gene Name: C10orf65, DHDPS2, DHDPSL, FLJ37472, NPL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025176: 89%, ENSRNOG00000029501: 90%
Entrez Gene ID: 112817
Uniprot ID: Q86XE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCYYRGRMSS |
| Gene Sequence | NGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCYYRGRMSS |
| Gene ID - Mouse | ENSMUSG00000025176 |
| Gene ID - Rat | ENSRNOG00000029501 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HOGA1 pAb (ATL-HPA039466) | |
| Datasheet | Anti HOGA1 pAb (ATL-HPA039466) Datasheet (External Link) |
| Vendor Page | Anti HOGA1 pAb (ATL-HPA039466) at Atlas Antibodies |
| Documents & Links for Anti HOGA1 pAb (ATL-HPA039466) | |
| Datasheet | Anti HOGA1 pAb (ATL-HPA039466) Datasheet (External Link) |
| Vendor Page | Anti HOGA1 pAb (ATL-HPA039466) |