Anti HNRNPU pAb (ATL-HPA041057)

Atlas Antibodies

Catalog No.: ATL-HPA041057-25

Protein Description: heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
Gene Name: HNRNPU
Alternative Gene Name: hnRNPU, HNRPU, SAF-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111145: 100%, ENSRNOG00000033790: 98%
Entrez Gene ID: 3192
Uniprot ID: Q00839
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDT
• Gene Sequence: TEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDT
• Gene ID - Mouse: ENSMUSG00000111145
• Gene ID - Rat: ENSRNOG00000033790
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.