Anti HNRNPR pAb (ATL-HPA026092 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026092-25

Protein Description: heterogeneous nuclear ribonucleoprotein R
Gene Name: HNRNPR
Alternative Gene Name: hnRNP-R, HNRPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066037: 100%, ENSRNOG00000011910: 98%
Entrez Gene ID: 10236
Uniprot ID: O43390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQT
• Gene Sequence: MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQT
• Gene ID - Mouse: ENSMUSG00000066037
• Gene ID - Rat: ENSRNOG00000011910
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HNRNPR pAb (ATL-HPA026092 w/enhanced validation) – 4 Found

Ghanawi, Hanaa; Hennlein, Luisa; Zare, Abdolhossein; Bader, Jakob; Salehi, Saeede; Hornburg, Daniel; Ji, Changhe; Sivadasan, Rajeeve; Drepper, Carsten; Meissner, Felix; Mann, Matthias; Jablonka, Sibylle; Briese, Michael; Sendtner, Michael. Loss of full-length hnRNP R isoform impairs DNA damage response in motoneurons by inhibiting Yb1 recruitment to chromatin. Nucleic Acids Research. 2021;49(21):12284-12305. 

Dombert, Benjamin; Sivadasan, Rajeeve; Simon, Christian M; Jablonka, Sibylle; Sendtner, Michael. Presynaptic localization of Smn and hnRNP R in axon terminals of embryonic and postnatal mouse motoneurons. Plos One. 9(10):e110846. 

Duijkers, Floor A; McDonald, Andrew; Janssens, Georges E; Lezzerini, Marco; Jongejan, Aldo; van Koningsbruggen, Silvana; Leeuwenburgh-Pronk, Wendela G; Wlodarski, Marcin W; Moutton, Sébastien; Tran-Mau-Them, Frédéric; Thauvin-Robinet, Christel; Faivre, Laurence; Monaghan, Kristin G; Smol, Thomas; Boute-Benejean, Odile; Ladda, Roger L; Sell, Susan L; Bruel, Ange-Line; Houtkooper, Riekelt H; MacInnes, Alyson W. HNRNPR Variants that Impair Homeobox Gene Expression Drive Developmental Disorders in Humans. American Journal Of Human Genetics. 2019;104(6):1040-1059. 

Zaepfel, Benjamin L; Rothstein, Jeffrey D. Polyadenylated RNA and RNA-Binding Proteins Exhibit Unique Response to Hyperosmotic Stress. Frontiers In Cell And Developmental Biology. 9( 34970554):809859.