Anti HNRNPR pAb (ATL-HPA026092 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026092-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HNRNPR
Alternative Gene Name: hnRNP-R, HNRPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066037: 100%, ENSRNOG00000011910: 98%
Entrez Gene ID: 10236
Uniprot ID: O43390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQT |
| Gene Sequence | MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQT |
| Gene ID - Mouse | ENSMUSG00000066037 |
| Gene ID - Rat | ENSRNOG00000011910 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HNRNPR pAb (ATL-HPA026092 w/enhanced validation) | |
| Datasheet | Anti HNRNPR pAb (ATL-HPA026092 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HNRNPR pAb (ATL-HPA026092 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HNRNPR pAb (ATL-HPA026092 w/enhanced validation) | |
| Datasheet | Anti HNRNPR pAb (ATL-HPA026092 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HNRNPR pAb (ATL-HPA026092 w/enhanced validation) |
| Citations for Anti HNRNPR pAb (ATL-HPA026092 w/enhanced validation) – 4 Found |
| Ghanawi, Hanaa; Hennlein, Luisa; Zare, Abdolhossein; Bader, Jakob; Salehi, Saeede; Hornburg, Daniel; Ji, Changhe; Sivadasan, Rajeeve; Drepper, Carsten; Meissner, Felix; Mann, Matthias; Jablonka, Sibylle; Briese, Michael; Sendtner, Michael. Loss of full-length hnRNP R isoform impairs DNA damage response in motoneurons by inhibiting Yb1 recruitment to chromatin. Nucleic Acids Research. 2021;49(21):12284-12305. PubMed |
| Dombert, Benjamin; Sivadasan, Rajeeve; Simon, Christian M; Jablonka, Sibylle; Sendtner, Michael. Presynaptic localization of Smn and hnRNP R in axon terminals of embryonic and postnatal mouse motoneurons. Plos One. 9(10):e110846. PubMed |
| Duijkers, Floor A; McDonald, Andrew; Janssens, Georges E; Lezzerini, Marco; Jongejan, Aldo; van Koningsbruggen, Silvana; Leeuwenburgh-Pronk, Wendela G; Wlodarski, Marcin W; Moutton, Sébastien; Tran-Mau-Them, Frédéric; Thauvin-Robinet, Christel; Faivre, Laurence; Monaghan, Kristin G; Smol, Thomas; Boute-Benejean, Odile; Ladda, Roger L; Sell, Susan L; Bruel, Ange-Line; Houtkooper, Riekelt H; MacInnes, Alyson W. HNRNPR Variants that Impair Homeobox Gene Expression Drive Developmental Disorders in Humans. American Journal Of Human Genetics. 2019;104(6):1040-1059. PubMed |
| Zaepfel, Benjamin L; Rothstein, Jeffrey D. Polyadenylated RNA and RNA-Binding Proteins Exhibit Unique Response to Hyperosmotic Stress. Frontiers In Cell And Developmental Biology. 9( 34970554):809859. PubMed |