Anti HNRNPK pAb (ATL-HPA007644)

Atlas Antibodies

Catalog No.: ATL-HPA007644-25

Protein Description: heterogeneous nuclear ribonucleoprotein K
Gene Name: HNRNPK
Alternative Gene Name: CSBP, HNRPK, TUNP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021546: 100%, ENSRNOG00000019113: 100%
Entrez Gene ID: 3190
Uniprot ID: P61978
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVS
• Gene Sequence: TEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVS
• Gene ID - Mouse: ENSMUSG00000021546
• Gene ID - Rat: ENSRNOG00000019113
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HNRNPK pAb (ATL-HPA007644) – 1 Found

Polisetty, Ravindra Varma; Gautam, Poonam; Gupta, Manoj Kumar; Sharma, Rakesh; Gowda, Harsha; Renu, Durairaj; Shivakumar, Bhadravathi Marigowda; Lakshmikantha, Akhila; Mariswamappa, Kiran; Ankathi, Praveen; Purohit, Aniruddh K; Uppin, Megha S; Sundaram, Challa; Sirdeshmukh, Ravi. Microsomal membrane proteome of low grade diffuse astrocytomas: Differentially expressed proteins and candidate surveillance biomarkers. Scientific Reports. 2016;6( 27246909):26882.