Anti HNRNPH2 pAb (ATL-HPA016884)

Atlas Antibodies

Catalog No.:
ATL-HPA016884-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: heterogeneous nuclear ribonucleoprotein H2 (H')
Gene Name: HNRNPH2
Alternative Gene Name: FTP3, hnRNPH', HNRPH', HNRPH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045427: 99%, ENSRNOG00000011661: 99%
Entrez Gene ID: 3188
Uniprot ID: P55795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FIYTREGRPSGEAFVELESEEEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFAS
Gene Sequence FIYTREGRPSGEAFVELESEEEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFAS
Gene ID - Mouse ENSMUSG00000045427
Gene ID - Rat ENSRNOG00000011661
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HNRNPH2 pAb (ATL-HPA016884)
Datasheet Anti HNRNPH2 pAb (ATL-HPA016884) Datasheet (External Link)
Vendor Page Anti HNRNPH2 pAb (ATL-HPA016884) at Atlas Antibodies

Documents & Links for Anti HNRNPH2 pAb (ATL-HPA016884)
Datasheet Anti HNRNPH2 pAb (ATL-HPA016884) Datasheet (External Link)
Vendor Page Anti HNRNPH2 pAb (ATL-HPA016884)