Anti HNRNPH2 pAb (ATL-HPA001359)

Atlas Antibodies

Catalog No.: ATL-HPA001359-25

Protein Description: heterogeneous nuclear ribonucleoprotein H2 (H')
Gene Name: HNRNPH2
Alternative Gene Name: FTP3, hnRNPH', HNRPH', HNRPH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045427: 100%, ENSRNOG00000011661: 99%
Entrez Gene ID: 3188
Uniprot ID: P55795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQ
• Gene Sequence: DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQ
• Gene ID - Mouse: ENSMUSG00000045427
• Gene ID - Rat: ENSRNOG00000011661
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HNRNPH2 pAb (ATL-HPA001359) – 1 Found

Rappe, Ulrike; Schlechter, Tanja; Aschoff, Moritz; Hotz-Wagenblatt, Agnes; Hofmann, Ilse. Nuclear ARVCF protein binds splicing factors and contributes to the regulation of alternative splicing. The Journal Of Biological Chemistry. 2014;289(18):12421-34.