Anti HNRNPD pAb (ATL-HPA004911)

Atlas Antibodies

Catalog No.: ATL-HPA004911-25

Protein Description: heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)
Gene Name: HNRNPD
Alternative Gene Name: AUF1, HNRPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000568: 100%, ENSRNOG00000002292: 100%
Entrez Gene ID: 3184
Uniprot ID: Q14103
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVS
• Gene Sequence: RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVS
• Gene ID - Mouse: ENSMUSG00000000568
• Gene ID - Rat: ENSRNOG00000002292
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HNRNPD pAb (ATL-HPA004911) – 2 Found

Peters, Dominik; Radine, Claudia; Reese, Alina; Budach, Wilfried; Sohn, Dennis; Jänicke, Reiner U. The DEAD-box RNA helicase DDX41 is a novel repressor of p21(WAF1/CIP1) mRNA translation. The Journal Of Biological Chemistry. 2017;292(20):8331-8341. 

Ricciardi, Luca; Col, Jessica Dal; Casolari, Paolo; Memoli, Domenico; Conti, Valeria; Vatrella, Alessandro; Vonakis, Becky M; Papi, Alberto; Caramori, Gaetano; Stellato, Cristiana. Differential expression of RNA-binding proteins in bronchial epithelium of stable COPD patients. International Journal Of Chronic Obstructive Pulmonary Disease. 13( 30349226):3173-3190.