Anti HNRNPA2B1 pAb (ATL-HPA001666)

Atlas Antibodies

SKU: ATL-HPA001666-100

• 
• 

Protein Description: heterogeneous nuclear ribonucleoprotein A2/B1
Gene Name: HNRNPA2B1
Alternative Gene Name: HNRPA2B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004980: 100%, ENSRNOG00000011175: 100%
Entrez Gene ID: 3181
Uniprot ID: P22626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL
• Gene Sequence: VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL
• Gene ID - Mouse: ENSMUSG00000004980
• Gene ID - Rat: ENSRNOG00000011175
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HNRNPA2B1 pAb (ATL-HPA001666) – 5 Found

Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759. 

Kim, Hong Joo; Mohassel, Payam; Donkervoort, Sandra; Guo, Lin; O'Donovan, Kevin; Coughlin, Maura; Lornage, Xaviere; Foulds, Nicola; Hammans, Simon R; Foley, A Reghan; Fare, Charlotte M; Ford, Alice F; Ogasawara, Masashi; Sato, Aki; Iida, Aritoshi; Munot, Pinki; Ambegaonkar, Gautam; Phadke, Rahul; O'Donovan, Dominic G; Buchert, Rebecca; Grimmel, Mona; Töpf, Ana; Zaharieva, Irina T; Brady, Lauren; Hu, Ying; Lloyd, Thomas E; Klein, Andrea; Steinlin, Maja; Kuster, Alice; Mercier, Sandra; Marcorelles, Pascale; Péréon, Yann; Fleurence, Emmanuelle; Manzur, Adnan; Ennis, Sarah; Upstill-Goddard, Rosanna; Bello, Luca; Bertolin, Cinzia; Pegoraro, Elena; Salviati, Leonardo; French, Courtney E; Shatillo, Andriy; Raymond, F Lucy; Haack, Tobias B; Quijano-Roy, Susana; Böhm, Johann; Nelson, Isabelle; Stojkovic, Tanya; Evangelista, Teresinha; Straub, Volker; Romero, Norma B; Laporte, Jocelyn; Muntoni, Francesco; Nishino, Ichizo; Tarnopolsky, Mark A; Shorter, James; Bönnemann, Carsten G; Taylor, J Paul. Heterozygous frameshift variants in HNRNPA2B1 cause early-onset oculopharyngeal muscular dystrophy. Nature Communications. 2022;13(1):2306. 

Liu, Yanbin; Zhang, Hui; Li, Xingzhi; Zhang, Changming; Huang, Haide. Identification of anti-tumoral feedback loop between VHLα and hnRNPA2B1 in renal cancer. Cell Death & Disease. 2020;11(8):688. 

Zhou, Xiaoju; Brown, Brooke A; Siegel, Amanda P; El Masry, Mohamed S; Zeng, Xuyao; Song, Woran; Das, Amitava; Khandelwal, Puneet; Clark, Andrew; Singh, Kanhaiya; Guda, Poornachander R; Gorain, Mahadeo; Timsina, Lava; Xuan, Yi; Jacobson, Stephen C; Novotny, Milos V; Roy, Sashwati; Agarwal, Mangilal; Lee, Robert J; Sen, Chandan K; Clemmer, David E; Ghatak, Subhadip. Exosome-Mediated Crosstalk between Keratinocytes and Macrophages in Cutaneous Wound Healing. Acs Nano. 2020;14(10):12732-12748. 

Condic, Mateja; Thiesler, Thore; Staerk, Christian; Klümper, Niklas; Ellinger, Jörg; Egger, Eva K; Kübler, Kirsten; Kristiansen, Glen; Mustea, Alexander; Ralser, Damian J. N6-methyladenosine RNA modification (m6A) is of prognostic value in HPV-dependent vulvar squamous cell carcinoma. Bmc Cancer. 2022;22(1):943.