Anti HNRNPA1 pAb (ATL-HPA001609)

Atlas Antibodies

SKU: ATL-HPA001609-25

• 
• 

Protein Description: heterogeneous nuclear ribonucleoprotein A1
Gene Name: HNRNPA1
Alternative Gene Name: hnRNP-A1, hnRNPA1, HNRPA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046434: 80%, ENSRNOG00000036839: 80%
Entrez Gene ID: 3178
Uniprot ID: P09651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETTDESLRSHFERWGMLTDCAVMRDPNTKRSRGFGFVTYATVEEVDAATNARPHKVDGKVVEPRRTVSREDYQRSGAHLTVKKIFVGGIKENTEKHQLRDYFEQHGKMEVIEIMTEAVARKGALPL
• Gene Sequence: ETTDESLRSHFERWGMLTDCAVMRDPNTKRSRGFGFVTYATVEEVDAATNARPHKVDGKVVEPRRTVSREDYQRSGAHLTVKKIFVGGIKENTEKHQLRDYFEQHGKMEVIEIMTEAVARKGALPL
• Gene ID - Mouse: ENSMUSG00000046434
• Gene ID - Rat: ENSRNOG00000036839
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HNRNPA1 pAb (ATL-HPA001609) – 1 Found

Anderton, Brittany; Camarda, Roman; Balakrishnan, Sanjeev; Balakrishnan, Asha; Kohnz, Rebecca A; Lim, Lionel; Evason, Kimberley J; Momcilovic, Olga; Kruttwig, Klaus; Huang, Qiang; Xu, Guowang; Nomura, Daniel K; Goga, Andrei. MYC-driven inhibition of the glutamate-cysteine ligase promotes glutathione depletion in liver cancer. Embo Reports. 2017;18(4):569-585.