Anti HNRNPA0 pAb (ATL-HPA036569 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036569-25

• 
• 
• 

Protein Description: heterogeneous nuclear ribonucleoprotein A0
Gene Name: HNRNPA0
Alternative Gene Name: hnRNPA0, HNRPA0
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007836: 93%, ENSRNOG00000039876: 93%
Entrez Gene ID: 10949
Uniprot ID: Q13151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGG
• Gene Sequence: RGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGG
• Gene ID - Mouse: ENSMUSG00000007836
• Gene ID - Rat: ENSRNOG00000039876
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HNRNPA0 pAb (ATL-HPA036569 w/enhanced validation) – 1 Found

Xu, Lei; Yates, Cecelia C; Lockyer, Pamela; Xie, Liang; Bevilacqua, Ariana; He, Jun; Lander, Cynthia; Patterson, Cam; Willis, Monte. MMI-0100 inhibits cardiac fibrosis in myocardial infarction by direct actions on cardiomyocytes and fibroblasts via MK2 inhibition. Journal Of Molecular And Cellular Cardiology. 2014;77( 25257914):86-101.