Anti HNMT pAb (ATL-HPA035480)

Atlas Antibodies

Catalog No.:
ATL-HPA035480-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: histamine N-methyltransferase
Gene Name: HNMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026986: 83%, ENSRNOG00000005223: 83%
Entrez Gene ID: 3176
Uniprot ID: P50135
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Gene Sequence TSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Gene ID - Mouse ENSMUSG00000026986
Gene ID - Rat ENSRNOG00000005223
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HNMT pAb (ATL-HPA035480)
Datasheet Anti HNMT pAb (ATL-HPA035480) Datasheet (External Link)
Vendor Page Anti HNMT pAb (ATL-HPA035480) at Atlas Antibodies

Documents & Links for Anti HNMT pAb (ATL-HPA035480)
Datasheet Anti HNMT pAb (ATL-HPA035480) Datasheet (External Link)
Vendor Page Anti HNMT pAb (ATL-HPA035480)