Anti HNF4G pAb (ATL-HPA005438 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA005438-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: hepatocyte nuclear factor 4, gamma
Gene Name: HNF4G
Alternative Gene Name: NR2A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017688: 94%, ENSRNOG00000008971: 94%
Entrez Gene ID: 3174
Uniprot ID: Q14541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ
Gene Sequence WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ
Gene ID - Mouse ENSMUSG00000017688
Gene ID - Rat ENSRNOG00000008971
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HNF4G pAb (ATL-HPA005438 w/enhanced validation)
Datasheet Anti HNF4G pAb (ATL-HPA005438 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HNF4G pAb (ATL-HPA005438 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HNF4G pAb (ATL-HPA005438 w/enhanced validation)
Datasheet Anti HNF4G pAb (ATL-HPA005438 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HNF4G pAb (ATL-HPA005438 w/enhanced validation)
Citations for Anti HNF4G pAb (ATL-HPA005438 w/enhanced validation) – 4 Found
Shukla, Shipra; Cyrta, Joanna; Murphy, Devan A; Walczak, Edward G; Ran, Leili; Agrawal, Praveen; Xie, Yuanyuan; Chen, Yuedan; Wang, Shangqian; Zhan, Yu; Li, Dan; Wong, Elissa W P; Sboner, Andrea; Beltran, Himisha; Mosquera, Juan Miguel; Sher, Jessica; Cao, Zhen; Wongvipat, John; Koche, Richard P; Gopalan, Anuradha; Zheng, Deyou; Rubin, Mark A; Scher, Howard I; Chi, Ping; Chen, Yu. Aberrant Activation of a Gastrointestinal Transcriptional Circuit in Prostate Cancer Mediates Castration Resistance. Cancer Cell. 2017;32(6):792-806.e7.  PubMed
Lindeboom, Rik Gh; van Voorthuijsen, Lisa; Oost, Koen C; Rodríguez-Colman, Maria J; Luna-Velez, Maria V; Furlan, Cristina; Baraille, Floriane; Jansen, Pascal Wtc; Ribeiro, Agnès; Burgering, Boudewijn Mt; Snippert, Hugo J; Vermeulen, Michiel. Integrative multi-omics analysis of intestinal organoid differentiation. Molecular Systems Biology. 2018;14(6):e8227.  PubMed
Lei, Xuqiu; Ketelut-Carneiro, Natalia; Shmuel-Galia, Liraz; Xu, Weili; Wilson, Ruth; Vierbuchen, Tim; Chen, Yongzhi; Reboldi, Andrea; Kang, Joonsoo; Edelblum, Karen L; Ward, Doyle; Fitzgerald, Katherine A. Epithelial HNF4A shapes the intraepithelial lymphocyte compartment via direct regulation of immune signaling molecules. The Journal Of Experimental Medicine. 2022;219(8)  PubMed
Che, Hongmin; Zheng, Qi; Liao, Zijun; Zhang, Lu. HNF4G accelerates glioma progression by facilitating NRP1 transcription. Oncology Letters. 2023;25(3):102.  PubMed