Anti HNF1A pAb (ATL-HPA035231 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA035231-25
  • Immunohistochemistry analysis in human small intestine and lymph node tissues using HPA035231 antibody. Corresponding HNF1A RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
  • Western blot analysis in human cell lines Caco-2 and U2OS using Anti-HNF1A antibody. Corresponding HNF1A RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: HNF1 homeobox A
Gene Name: HNF1A
Alternative Gene Name: HCF-1A, HNF1, LFB1, MODY3, TCF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029556: 92%, ENSRNOG00000001183: 92%
Entrez Gene ID: 6927
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VYNWFANRRKEEAFRHKLAMDTYSGPPPGPGPGPALPAHSSPGLPPPALSPSKVHGVRYGQPATSETAEVPSSSGG
Gene Sequence VYNWFANRRKEEAFRHKLAMDTYSGPPPGPGPGPALPAHSSPGLPPPALSPSKVHGVRYGQPATSETAEVPSSSGG
Gene ID - Mouse ENSMUSG00000029556
Gene ID - Rat ENSRNOG00000001183
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HNF1A pAb (ATL-HPA035231 w/enhanced validation)
Datasheet Anti HNF1A pAb (ATL-HPA035231 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HNF1A pAb (ATL-HPA035231 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HNF1A pAb (ATL-HPA035231 w/enhanced validation)
Datasheet Anti HNF1A pAb (ATL-HPA035231 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HNF1A pAb (ATL-HPA035231 w/enhanced validation)