Anti HN1L pAb (ATL-HPA041908)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041908-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: HN1L
Alternative Gene Name: C16orf34, FLJ13092, KIAA1426, L11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024165: 90%, ENSRNOG00000024661: 87%
Entrez Gene ID: 90861
Uniprot ID: Q9H910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDI |
| Gene Sequence | GSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDI |
| Gene ID - Mouse | ENSMUSG00000024165 |
| Gene ID - Rat | ENSRNOG00000024661 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HN1L pAb (ATL-HPA041908) | |
| Datasheet | Anti HN1L pAb (ATL-HPA041908) Datasheet (External Link) |
| Vendor Page | Anti HN1L pAb (ATL-HPA041908) at Atlas Antibodies |
| Documents & Links for Anti HN1L pAb (ATL-HPA041908) | |
| Datasheet | Anti HN1L pAb (ATL-HPA041908) Datasheet (External Link) |
| Vendor Page | Anti HN1L pAb (ATL-HPA041908) |
| Citations for Anti HN1L pAb (ATL-HPA041908) – 3 Found |
| Li, Lei; Zeng, Ting-Ting; Zhang, Bao-Zhu; Li, Yan; Zhu, Ying-Hui; Guan, Xin-Yuan. Overexpression of HN1L promotes cell malignant proliferation in non-small cell lung cancer. Cancer Biology & Therapy. 2017;18(11):904-915. PubMed |
| Liu, Yi; Choi, Dong Soon; Sheng, Jianting; Ensor, Joe E; Liang, Diana Hwang; Rodriguez-Aguayo, Cristian; Polley, Amanda; Benz, Steve; Elemento, Olivier; Verma, Akanksha; Cong, Yang; Wong, Helen; Qian, Wei; Li, Zheng; Granados-Principal, Sergio; Lopez-Berestein, Gabriel; Landis, Melissa D; Rosato, Roberto R; Dave, Bhuvanesh; Wong, Stephen; Marchetti, Dario; Sood, Anil K; Chang, Jenny C. HN1L Promotes Triple-Negative Breast Cancer Stem Cells through LEPR-STAT3 Pathway. Stem Cell Reports. 2018;10(1):212-227. PubMed |
| Zeng, Ting-Ting; Deng, Tian-Hao; Liu, Zhen; Zhan, Jia-Rong; Ma, Yuan-Zhen; Yan, Yuan-Yuan; Sun, Xiao; Zhu, Ying-Hui; Li, Yan; Guan, Xin-Yuan; Li, Lei. HN1L/AP-2γ/PLK1 signaling drives tumor progression and chemotherapy resistance in esophageal squamous cell carcinoma. Cell Death & Disease. 2022;13(12):1026. PubMed |