Anti HN1L pAb (ATL-HPA041888)

Atlas Antibodies

Catalog No.: ATL-HPA041888-25

Protein Description: hematological and neurological expressed 1-like
Gene Name: HN1L
Alternative Gene Name: C16orf34, FLJ13092, KIAA1426, L11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024165: 74%, ENSRNOG00000024661: 79%
Entrez Gene ID: 90861
Uniprot ID: Q9H910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISF
• Gene Sequence: FGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISF
• Gene ID - Mouse: ENSMUSG00000024165
• Gene ID - Rat: ENSRNOG00000024661
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.