Anti HN1L pAb (ATL-HPA041888)

Atlas Antibodies

SKU:
ATL-HPA041888-25
  • Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hematological and neurological expressed 1-like
Gene Name: HN1L
Alternative Gene Name: C16orf34, FLJ13092, KIAA1426, L11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024165: 74%, ENSRNOG00000024661: 79%
Entrez Gene ID: 90861
Uniprot ID: Q9H910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISF
Gene Sequence FGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISF
Gene ID - Mouse ENSMUSG00000024165
Gene ID - Rat ENSRNOG00000024661
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HN1L pAb (ATL-HPA041888)
Datasheet Anti HN1L pAb (ATL-HPA041888) Datasheet (External Link)
Vendor Page Anti HN1L pAb (ATL-HPA041888) at Atlas Antibodies

Documents & Links for Anti HN1L pAb (ATL-HPA041888)
Datasheet Anti HN1L pAb (ATL-HPA041888) Datasheet (External Link)
Vendor Page Anti HN1L pAb (ATL-HPA041888)