Anti HMOX2 pAb (ATL-HPA040611)

Atlas Antibodies

Catalog No.:
ATL-HPA040611-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: heme oxygenase (decycling) 2
Gene Name: HMOX2
Alternative Gene Name: HO-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004070: 84%, ENSRNOG00000003773: 88%
Entrez Gene ID: 3163
Uniprot ID: P30519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPEL
Gene Sequence MERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPEL
Gene ID - Mouse ENSMUSG00000004070
Gene ID - Rat ENSRNOG00000003773
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HMOX2 pAb (ATL-HPA040611)
Datasheet Anti HMOX2 pAb (ATL-HPA040611) Datasheet (External Link)
Vendor Page Anti HMOX2 pAb (ATL-HPA040611) at Atlas Antibodies

Documents & Links for Anti HMOX2 pAb (ATL-HPA040611)
Datasheet Anti HMOX2 pAb (ATL-HPA040611) Datasheet (External Link)
Vendor Page Anti HMOX2 pAb (ATL-HPA040611)