Anti HMOX1 pAb (ATL-HPA000635 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000635-25

Protein Description: heme oxygenase (decycling) 1
Gene Name: HMOX1
Alternative Gene Name: bK286B10, HO-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005413: 86%, ENSRNOG00000014117: 85%
Entrez Gene ID: 3162
Uniprot ID: P09601
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAF
• Gene Sequence: QDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAF
• Gene ID - Mouse: ENSMUSG00000005413
• Gene ID - Rat: ENSRNOG00000014117
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HMOX1 pAb (ATL-HPA000635 w/enhanced validation) – 3 Found

Halin Bergström, Sofia; Nilsson, Maria; Adamo, Hanibal; Thysell, Elin; Jernberg, Emma; Stattin, Pär; Widmark, Anders; Wikström, Pernilla; Bergh, Anders. Extratumoral Heme Oxygenase-1 (HO-1) Expressing Macrophages Likely Promote Primary and Metastatic Prostate Tumor Growth. Plos One. 11(6):e0157280. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Lupasco, Tatiana; He, Zhiguo; Cassagne, Myriam; Sagnial, Tomy; Brion, Lise; Fournié, Pierre; Gain, Philippe; Thuret, Gilles; Allouche, Michèle; Malecaze, François; Simon, Michel; Galiacy, Stéphane D. Corneal epithelium in keratoconus underexpresses active NRF2 and a subset of oxidative stress-related genes. Plos One. 17(10):e0273807.