Anti HMMR pAb (ATL-HPA040025 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040025-25

Protein Description: hyaluronan-mediated motility receptor (RHAMM)
Gene Name: HMMR
Alternative Gene Name: CD168, RHAMM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020330: 59%, ENSRNOG00000059894: 62%
Entrez Gene ID: 3161
Uniprot ID: O75330
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKVAKAGKNAEDVQHQILATESSNQEYVRMLLDLQTKSALKET
• Gene Sequence: SSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKVAKAGKNAEDVQHQILATESSNQEYVRMLLDLQTKSALKET
• Gene ID - Mouse: ENSMUSG00000020330
• Gene ID - Rat: ENSRNOG00000059894
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HMMR pAb (ATL-HPA040025 w/enhanced validation) – 1 Found

van IJzendoorn, David G P; Szuhai, Karoly; Briaire-de Bruijn, Inge H; Kostine, Marie; Kuijjer, Marieke L; Bovée, Judith V M G. Machine learning analysis of gene expression data reveals novel diagnostic and prognostic biomarkers and identifies therapeutic targets for soft tissue sarcomas. Plos Computational Biology. 2019;15(2):e1006826.