Anti HMMR pAb (ATL-HPA040025 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040025-25
  • Immunohistochemistry analysis in human testis and prostate tissues using HPA040025 antibody. Corresponding HMMR RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hyaluronan-mediated motility receptor (RHAMM)
Gene Name: HMMR
Alternative Gene Name: CD168, RHAMM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020330: 59%, ENSRNOG00000059894: 62%
Entrez Gene ID: 3161
Uniprot ID: O75330
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKVAKAGKNAEDVQHQILATESSNQEYVRMLLDLQTKSALKET
Gene Sequence SSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKVAKAGKNAEDVQHQILATESSNQEYVRMLLDLQTKSALKET
Gene ID - Mouse ENSMUSG00000020330
Gene ID - Rat ENSRNOG00000059894
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HMMR pAb (ATL-HPA040025 w/enhanced validation)
Datasheet Anti HMMR pAb (ATL-HPA040025 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HMMR pAb (ATL-HPA040025 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HMMR pAb (ATL-HPA040025 w/enhanced validation)
Datasheet Anti HMMR pAb (ATL-HPA040025 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HMMR pAb (ATL-HPA040025 w/enhanced validation)



Citations for Anti HMMR pAb (ATL-HPA040025 w/enhanced validation) – 1 Found
van IJzendoorn, David G P; Szuhai, Karoly; Briaire-de Bruijn, Inge H; Kostine, Marie; Kuijjer, Marieke L; Bovée, Judith V M G. Machine learning analysis of gene expression data reveals novel diagnostic and prognostic biomarkers and identifies therapeutic targets for soft tissue sarcomas. Plos Computational Biology. 2019;15(2):e1006826.  PubMed