Anti HMGN5 pAb (ATL-HPA000511)

Atlas Antibodies

Catalog No.:
ATL-HPA000511-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: high mobility group nucleosome binding domain 5
Gene Name: HMGN5
Alternative Gene Name: NSBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031245: 61%, ENSRNOG00000049192: 57%
Entrez Gene ID: 79366
Uniprot ID: P82970
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVK
Gene Sequence LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVK
Gene ID - Mouse ENSMUSG00000031245
Gene ID - Rat ENSRNOG00000049192
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HMGN5 pAb (ATL-HPA000511)
Datasheet Anti HMGN5 pAb (ATL-HPA000511) Datasheet (External Link)
Vendor Page Anti HMGN5 pAb (ATL-HPA000511) at Atlas Antibodies

Documents & Links for Anti HMGN5 pAb (ATL-HPA000511)
Datasheet Anti HMGN5 pAb (ATL-HPA000511) Datasheet (External Link)
Vendor Page Anti HMGN5 pAb (ATL-HPA000511)
Citations for Anti HMGN5 pAb (ATL-HPA000511) – 2 Found
Malicet, Cedric; Rochman, Mark; Postnikov, Yuri; Bustin, Michael. Distinct properties of human HMGN5 reveal a rapidly evolving but functionally conserved nucleosome binding protein. Molecular And Cellular Biology. 2011;31(13):2742-55.  PubMed
Zhang, Shaofei; Schones, Dustin E; Malicet, Cedric; Rochman, Mark; Zhou, Ming; Foisner, Roland; Bustin, Michael. High mobility group protein N5 (HMGN5) and lamina-associated polypeptide 2α (LAP2α) interact and reciprocally affect their genome-wide chromatin organization. The Journal Of Biological Chemistry. 2013;288(25):18104-9.  PubMed