Anti HMGN5 pAb (ATL-HPA000511)

Atlas Antibodies

SKU: ATL-HPA000511-25

• 
• 

Protein Description: high mobility group nucleosome binding domain 5
Gene Name: HMGN5
Alternative Gene Name: NSBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031245: 61%, ENSRNOG00000049192: 57%
Entrez Gene ID: 79366
Uniprot ID: P82970
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVK
• Gene Sequence: LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVK
• Gene ID - Mouse: ENSMUSG00000031245
• Gene ID - Rat: ENSRNOG00000049192
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HMGN5 pAb (ATL-HPA000511) – 2 Found

Malicet, Cedric; Rochman, Mark; Postnikov, Yuri; Bustin, Michael. Distinct properties of human HMGN5 reveal a rapidly evolving but functionally conserved nucleosome binding protein. Molecular And Cellular Biology. 2011;31(13):2742-55. 

Zhang, Shaofei; Schones, Dustin E; Malicet, Cedric; Rochman, Mark; Zhou, Ming; Foisner, Roland; Bustin, Michael. High mobility group protein N5 (HMGN5) and lamina-associated polypeptide 2α (LAP2α) interact and reciprocally affect their genome-wide chromatin organization. The Journal Of Biological Chemistry. 2013;288(25):18104-9.