Anti HMGN5 pAb (ATL-HPA000511)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000511-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HMGN5
Alternative Gene Name: NSBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031245: 61%, ENSRNOG00000049192: 57%
Entrez Gene ID: 79366
Uniprot ID: P82970
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVK |
| Gene Sequence | LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVK |
| Gene ID - Mouse | ENSMUSG00000031245 |
| Gene ID - Rat | ENSRNOG00000049192 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HMGN5 pAb (ATL-HPA000511) | |
| Datasheet | Anti HMGN5 pAb (ATL-HPA000511) Datasheet (External Link) |
| Vendor Page | Anti HMGN5 pAb (ATL-HPA000511) at Atlas Antibodies |
| Documents & Links for Anti HMGN5 pAb (ATL-HPA000511) | |
| Datasheet | Anti HMGN5 pAb (ATL-HPA000511) Datasheet (External Link) |
| Vendor Page | Anti HMGN5 pAb (ATL-HPA000511) |
| Citations for Anti HMGN5 pAb (ATL-HPA000511) – 2 Found |
| Malicet, Cedric; Rochman, Mark; Postnikov, Yuri; Bustin, Michael. Distinct properties of human HMGN5 reveal a rapidly evolving but functionally conserved nucleosome binding protein. Molecular And Cellular Biology. 2011;31(13):2742-55. PubMed |
| Zhang, Shaofei; Schones, Dustin E; Malicet, Cedric; Rochman, Mark; Zhou, Ming; Foisner, Roland; Bustin, Michael. High mobility group protein N5 (HMGN5) and lamina-associated polypeptide 2α (LAP2α) interact and reciprocally affect their genome-wide chromatin organization. The Journal Of Biological Chemistry. 2013;288(25):18104-9. PubMed |