Anti HMGCS2 pAb (ATL-HPA027442 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027442-25

• 
• 
• 

Protein Description: 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial)
Gene Name: HMGCS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027875: 81%, ENSRNOG00000019120: 79%
Entrez Gene ID: 3158
Uniprot ID: P54868
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALEVYFPAQYVDQTDLEKYNNVE
• Gene Sequence: ILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALEVYFPAQYVDQTDLEKYNNVE
• Gene ID - Mouse: ENSMUSG00000027875
• Gene ID - Rat: ENSRNOG00000019120
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HMGCS2 pAb (ATL-HPA027442 w/enhanced validation) – 1 Found

Labanca, Estefania; Bizzotto, Juan; Sanchis, Pablo; Anselmino, Nicolas; Yang, Jun; Shepherd, Peter D A; Paez, Alejandra; Antico-Arciuch, Valeria; Lage-Vickers, Sofia; Hoang, Anh G; Tang, Ximing; Raso, Maria Gabriela; Titus, Mark; Efstathiou, Eleni; Cotignola, Javier; Araujo, John; Logothetis, Christopher; Vazquez, Elba; Navone, Nora; Gueron, Geraldine. Prostate cancer castrate resistant progression usage of non-canonical androgen receptor signaling and ketone body fuel. Oncogene. 2021;40(44):6284-6298.