Anti HMGCS1 pAb (ATL-HPA036913)

Atlas Antibodies

SKU:
ATL-HPA036913-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity with a granular pattern in glandular cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble)
Gene Name: HMGCS1
Alternative Gene Name: HMGCS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093930: 96%, ENSRNOG00000016552: 96%
Entrez Gene ID: 3157
Uniprot ID: Q01581
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAPDVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWY
Gene Sequence TLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAPDVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWY
Gene ID - Mouse ENSMUSG00000093930
Gene ID - Rat ENSRNOG00000016552
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HMGCS1 pAb (ATL-HPA036913)
Datasheet Anti HMGCS1 pAb (ATL-HPA036913) Datasheet (External Link)
Vendor Page Anti HMGCS1 pAb (ATL-HPA036913) at Atlas Antibodies

Documents & Links for Anti HMGCS1 pAb (ATL-HPA036913)
Datasheet Anti HMGCS1 pAb (ATL-HPA036913) Datasheet (External Link)
Vendor Page Anti HMGCS1 pAb (ATL-HPA036913)