Anti HMGCL pAb (ATL-HPA004727 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA004727-25

• 
• 

Protein Description: 3-hydroxymethyl-3-methylglutaryl-CoA lyase
Gene Name: HMGCL
Alternative Gene Name: HL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028672: 84%, ENSRNOG00000009422: 86%
Entrez Gene ID: 3155
Uniprot ID: P35914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKISPAK
• Gene Sequence: GLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKISPAK
• Gene ID - Mouse: ENSMUSG00000028672
• Gene ID - Rat: ENSRNOG00000009422
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HMGCL pAb (ATL-HPA004727 w/enhanced validation) – 4 Found

Luo, Wenqi; Qin, Liting; Li, Bo; Liao, Zhipeng; Liang, Jiezhen; Xiao, Xiling; Xiao, Xue; Mo, Yingxi; Huang, Guangwu; Zhang, Zhe; Zhou, Xiaoying; Li, Ping. Inactivation of HMGCL promotes proliferation and metastasis of nasopharyngeal carcinoma by suppressing oxidative stress. Scientific Reports. 2017;7(1):11954. 

Martinez-Outschoorn, Ubaldo E; Lin, Zhao; Whitaker-Menezes, Diana; Howell, Anthony; Lisanti, Michael P; Sotgia, Federica. Ketone bodies and two-compartment tumor metabolism: stromal ketone production fuels mitochondrial biogenesis in epithelial cancer cells. Cell Cycle (Georgetown, Tex.). 2012;11(21):3956-63. 

Cui, Wanmeng; Luo, Wenqi; Zhou, Xiaohui; Lu, Yunliang; Xu, Wenqing; Zhong, Suhua; Feng, Guofei; Liang, Yushan; Liang, Libin; Mo, Yingxi; Xiao, Xue; Huang, Guangwu; Matskova, Liudmila; Zhang, Zhe; Li, Ping; Zhou, Xiaoying. Dysregulation of Ketone Body Metabolism Is Associated With Poor Prognosis for Clear Cell Renal Cell Carcinoma Patients. Frontiers In Oncology. 9( 31921677):1422. 

Labanca, Estefania; Bizzotto, Juan; Sanchis, Pablo; Anselmino, Nicolas; Yang, Jun; Shepherd, Peter D A; Paez, Alejandra; Antico-Arciuch, Valeria; Lage-Vickers, Sofia; Hoang, Anh G; Tang, Ximing; Raso, Maria Gabriela; Titus, Mark; Efstathiou, Eleni; Cotignola, Javier; Araujo, John; Logothetis, Christopher; Vazquez, Elba; Navone, Nora; Gueron, Geraldine. Prostate cancer castrate resistant progression usage of non-canonical androgen receptor signaling and ketone body fuel. Oncogene. 2021;40(44):6284-6298.