Anti HMGB2 pAb (ATL-HPA003506)

Atlas Antibodies

Catalog No.: ATL-HPA003506-25

Protein Description: high mobility group box 2
Gene Name: HMGB2
Alternative Gene Name: HMG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054717: 97%, ENSRNOG00000033321: 99%
Entrez Gene ID: 3148
Uniprot ID: P26583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE
• Gene Sequence: KSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE
• Gene ID - Mouse: ENSMUSG00000054717
• Gene ID - Rat: ENSRNOG00000033321
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HMGB2 pAb (ATL-HPA003506) – 2 Found

Tripathi, Alok; Shrinet, Kriti; Singh, Vinay Kumar; Kumar, Arvind. Molecular modelling and docking of Mus musculus HMGB1 inflammatory protein with CGA. Bioinformation. 15(7):467-473. 

Syed, Nazia; Chavan, Sandip; Sahasrabuddhe, Nandini A; Renuse, Santosh; Sathe, Gajanan; Nanjappa, Vishalakshi; Radhakrishnan, Aneesha; Raja, Remya; Pinto, Sneha M; Srinivasan, Anand; Prasad, T S Keshava; Srikumar, Kotteazeth; Gowda, Harsha; Santosh, Vani; Sidransky, David; Califano, Joseph A; Pandey, Akhilesh; Chatterjee, Aditi. Silencing of high-mobility group box 2 (HMGB2) modulates cisplatin and 5-fluorouracil sensitivity in head and neck squamous cell carcinoma. Proteomics. 2015;15(2-3):383-93.