Anti HMGB2 pAb (ATL-HPA003506)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003506-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: HMGB2
Alternative Gene Name: HMG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054717: 97%, ENSRNOG00000033321: 99%
Entrez Gene ID: 3148
Uniprot ID: P26583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE |
| Gene Sequence | KSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE |
| Gene ID - Mouse | ENSMUSG00000054717 |
| Gene ID - Rat | ENSRNOG00000033321 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HMGB2 pAb (ATL-HPA003506) | |
| Datasheet | Anti HMGB2 pAb (ATL-HPA003506) Datasheet (External Link) |
| Vendor Page | Anti HMGB2 pAb (ATL-HPA003506) at Atlas Antibodies |
| Documents & Links for Anti HMGB2 pAb (ATL-HPA003506) | |
| Datasheet | Anti HMGB2 pAb (ATL-HPA003506) Datasheet (External Link) |
| Vendor Page | Anti HMGB2 pAb (ATL-HPA003506) |
| Citations for Anti HMGB2 pAb (ATL-HPA003506) – 2 Found |
| Tripathi, Alok; Shrinet, Kriti; Singh, Vinay Kumar; Kumar, Arvind. Molecular modelling and docking of Mus musculus HMGB1 inflammatory protein with CGA. Bioinformation. 15(7):467-473. PubMed |
| Syed, Nazia; Chavan, Sandip; Sahasrabuddhe, Nandini A; Renuse, Santosh; Sathe, Gajanan; Nanjappa, Vishalakshi; Radhakrishnan, Aneesha; Raja, Remya; Pinto, Sneha M; Srinivasan, Anand; Prasad, T S Keshava; Srikumar, Kotteazeth; Gowda, Harsha; Santosh, Vani; Sidransky, David; Califano, Joseph A; Pandey, Akhilesh; Chatterjee, Aditi. Silencing of high-mobility group box 2 (HMGB2) modulates cisplatin and 5-fluorouracil sensitivity in head and neck squamous cell carcinoma. Proteomics. 2015;15(2-3):383-93. PubMed |