Anti HMCES pAb (ATL-HPA044968 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044968-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: HMCES
Alternative Gene Name: C3orf37, DC12, SRAPD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030060: 87%, ENSRNOG00000010474: 88%
Entrez Gene ID: 56941
Uniprot ID: Q96FZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNS |
| Gene Sequence | WRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNS |
| Gene ID - Mouse | ENSMUSG00000030060 |
| Gene ID - Rat | ENSRNOG00000010474 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HMCES pAb (ATL-HPA044968 w/enhanced validation) | |
| Datasheet | Anti HMCES pAb (ATL-HPA044968 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HMCES pAb (ATL-HPA044968 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HMCES pAb (ATL-HPA044968 w/enhanced validation) | |
| Datasheet | Anti HMCES pAb (ATL-HPA044968 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HMCES pAb (ATL-HPA044968 w/enhanced validation) |
| Citations for Anti HMCES pAb (ATL-HPA044968 w/enhanced validation) – 5 Found |
| Srivastava, Mrinal; Su, Dan; Zhang, Huimin; Chen, Zhen; Tang, Mengfan; Nie, Litong; Chen, Junjie. HMCES safeguards replication from oxidative stress and ensures error-free repair. Embo Reports. 2020;21(6):e49123. PubMed |
| Mohni, Kareem N; Wessel, Sarah R; Zhao, Runxiang; Wojciechowski, Andrea C; Luzwick, Jessica W; Layden, Hillary; Eichman, Brandt F; Thompson, Petria S; Mehta, Kavi P M; Cortez, David. HMCES Maintains Genome Integrity by Shielding Abasic Sites in Single-Strand DNA. Cell. 2019;176(1-2):144-153.e13. PubMed |
| Mehta, Kavi P M; Lovejoy, Courtney A; Zhao, Runxiang; Heintzman, Darren R; Cortez, David. HMCES Maintains Replication Fork Progression and Prevents Double-Strand Breaks in Response to APOBEC Deamination and Abasic Site Formation. Cell Reports. 2020;31(9):107705. PubMed |
| Biayna, Josep; Garcia-Cao, Isabel; Álvarez, Miguel M; Salvadores, Marina; Espinosa-Carrasco, Jose; McCullough, Marcel; Supek, Fran; Stracker, Travis H. Loss of the abasic site sensor HMCES is synthetic lethal with the activity of the APOBEC3A cytosine deaminase in cancer cells. Plos Biology. 2021;19(3):e3001176. PubMed |
| Wu, Lizhen; Shukla, Vipul; Yadavalli, Anurupa Devi; Dinesh, Ravi K; Xu, Dijin; Rao, Anjana; Schatz, David G. HMCES protects immunoglobulin genes specifically from deletions during somatic hypermutation. Genes & Development. 2022;36(7-8):433-450. PubMed |