Anti HMBS pAb (ATL-HPA006114)

Atlas Antibodies

Catalog No.: ATL-HPA006114-25

Protein Description: hydroxymethylbilane synthase
Gene Name: HMBS
Alternative Gene Name: PBGD, PORC, UPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032126: 94%, ENSRNOG00000010390: 94%
Entrez Gene ID: 3145
Uniprot ID: P08397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL
• Gene Sequence: QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL
• Gene ID - Mouse: ENSMUSG00000032126
• Gene ID - Rat: ENSRNOG00000010390
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.