Anti HMBS pAb (ATL-HPA006114)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006114-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: HMBS
Alternative Gene Name: PBGD, PORC, UPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032126: 94%, ENSRNOG00000010390: 94%
Entrez Gene ID: 3145
Uniprot ID: P08397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL |
| Gene Sequence | QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL |
| Gene ID - Mouse | ENSMUSG00000032126 |
| Gene ID - Rat | ENSRNOG00000010390 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HMBS pAb (ATL-HPA006114) | |
| Datasheet | Anti HMBS pAb (ATL-HPA006114) Datasheet (External Link) |
| Vendor Page | Anti HMBS pAb (ATL-HPA006114) at Atlas Antibodies |
| Documents & Links for Anti HMBS pAb (ATL-HPA006114) | |
| Datasheet | Anti HMBS pAb (ATL-HPA006114) Datasheet (External Link) |
| Vendor Page | Anti HMBS pAb (ATL-HPA006114) |