Anti HMBS pAb (ATL-HPA006114)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006114-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: HMBS
Alternative Gene Name: PBGD, PORC, UPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032126: 94%, ENSRNOG00000010390: 94%
Entrez Gene ID: 3145
Uniprot ID: P08397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL |
Gene Sequence | QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL |
Gene ID - Mouse | ENSMUSG00000032126 |
Gene ID - Rat | ENSRNOG00000010390 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HMBS pAb (ATL-HPA006114) | |
Datasheet | Anti HMBS pAb (ATL-HPA006114) Datasheet (External Link) |
Vendor Page | Anti HMBS pAb (ATL-HPA006114) at Atlas Antibodies |
Documents & Links for Anti HMBS pAb (ATL-HPA006114) | |
Datasheet | Anti HMBS pAb (ATL-HPA006114) Datasheet (External Link) |
Vendor Page | Anti HMBS pAb (ATL-HPA006114) |