Anti HMBS pAb (ATL-HPA006114)

Atlas Antibodies

Catalog No.:
ATL-HPA006114-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: hydroxymethylbilane synthase
Gene Name: HMBS
Alternative Gene Name: PBGD, PORC, UPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032126: 94%, ENSRNOG00000010390: 94%
Entrez Gene ID: 3145
Uniprot ID: P08397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL
Gene Sequence QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL
Gene ID - Mouse ENSMUSG00000032126
Gene ID - Rat ENSRNOG00000010390
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HMBS pAb (ATL-HPA006114)
Datasheet Anti HMBS pAb (ATL-HPA006114) Datasheet (External Link)
Vendor Page Anti HMBS pAb (ATL-HPA006114) at Atlas Antibodies

Documents & Links for Anti HMBS pAb (ATL-HPA006114)
Datasheet Anti HMBS pAb (ATL-HPA006114) Datasheet (External Link)
Vendor Page Anti HMBS pAb (ATL-HPA006114)